![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest |
![]() | Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) ![]() |
![]() | Family c.71.1.0: automated matches [191485] (1 protein) not a true family |
![]() | Protein automated matches [190777] (27 species) not a true protein |
![]() | Species Enterococcus faecalis [TaxId:226185] [237300] (2 PDB entries) |
![]() | Domain d4m7va1: 4m7v A:1-163 [237301] Other proteins in same PDB: d4m7va2 automated match to d4elha_ complexed with nap, rar |
PDB Entry: 4m7v (more details), 2.3 Å
SCOPe Domain Sequences for d4m7va1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4m7va1 c.71.1.0 (A:1-163) automated matches {Enterococcus faecalis [TaxId: 226185]} mlaaiwaqdeqgvigkegklpwhlpndlkffkektihntlvlgratfegmgcrplpnrtt ivltsnpdyqaegvlvmhsveeilayadkyegvtvigggsvvfkelipacdvlyrtmihe tfegdtffpeidwsvwekvatvpgvvdeknlyahdyetyhrnd
Timeline for d4m7va1: