Lineage for d4m7va1 (4m7v A:1-163)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2903429Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest
  4. 2903430Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) (S)
  5. 2904032Family c.71.1.0: automated matches [191485] (1 protein)
    not a true family
  6. 2904033Protein automated matches [190777] (28 species)
    not a true protein
  7. 2904175Species Enterococcus faecalis [TaxId:226185] [237300] (2 PDB entries)
  8. 2904177Domain d4m7va1: 4m7v A:1-163 [237301]
    Other proteins in same PDB: d4m7va2
    automated match to d4elha_
    complexed with nap, rar

Details for d4m7va1

PDB Entry: 4m7v (more details), 2.3 Å

PDB Description: Dihydrofolate reductase from Enterococcus faecalis complexed with NADP(H)and RAB-propyl
PDB Compounds: (A:) dihydrofolate reductase

SCOPe Domain Sequences for d4m7va1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4m7va1 c.71.1.0 (A:1-163) automated matches {Enterococcus faecalis [TaxId: 226185]}
mlaaiwaqdeqgvigkegklpwhlpndlkffkektihntlvlgratfegmgcrplpnrtt
ivltsnpdyqaegvlvmhsveeilayadkyegvtvigggsvvfkelipacdvlyrtmihe
tfegdtffpeidwsvwekvatvpgvvdeknlyahdyetyhrnd

SCOPe Domain Coordinates for d4m7va1:

Click to download the PDB-style file with coordinates for d4m7va1.
(The format of our PDB-style files is described here.)

Timeline for d4m7va1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4m7va2