| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) ![]() binds metal ion (magnesium or manganese) in conserved site inside barrel N-terminal alpha+beta domain is common to this superfamily |
| Family c.1.11.2: D-glucarate dehydratase-like [51609] (15 proteins) |
| Protein automated matches [226997] (13 species) not a true protein |
| Species Pseudomonas putida [TaxId:303] [228631] (7 PDB entries) |
| Domain d4m6ub2: 4m6u B:133-359 [237299] Other proteins in same PDB: d4m6ua1, d4m6ub1 automated match to d3uxkd2 complexed with mg, ttn |
PDB Entry: 4m6u (more details), 1.8 Å
SCOPe Domain Sequences for d4m6ub2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4m6ub2 c.1.11.2 (B:133-359) automated matches {Pseudomonas putida [TaxId: 303]}
pvqaydshsldgvklateravtaaelgfravktkigypaldqdlavvrsirqavgddfgi
mvdynqsldvpaaikrsqalqqegvtwieeptlqhdyeghqriqsklnvpvqmgenwlgp
eemfkalsigacrlampdamkiggvtgwirasalaqqfgipmsshlfqeisahllaatpt
ahwlerldlagsvieptltfeggnavipdlpgvgiiwrekeigkylv
Timeline for d4m6ub2: