![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.2: Lysozyme-like [53954] (1 superfamily) common alpha+beta motif for the active site region |
![]() | Superfamily d.2.1: Lysozyme-like [53955] (12 families) ![]() |
![]() | Family d.2.1.0: automated matches [191411] (1 protein) not a true family |
![]() | Protein automated matches [190563] (18 species) not a true protein |
![]() | Species Maize (Zea mays) [TaxId:4577] [237294] (1 PDB entry) |
![]() | Domain d4mcka1: 4mck A:1-198 [237295] Other proteins in same PDB: d4mcka2 automated match to d3hbex_ |
PDB Entry: 4mck (more details), 1.5 Å
SCOPe Domain Sequences for d4mcka1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4mcka1 d.2.1.0 (A:1-198) automated matches {Maize (Zea mays) [TaxId: 4577]} vvsdaffngiknqagsgcegknfytrsaflsavnaypgfahggtevegkreiaaffahvt hqtghfcyiseinksnaycdasnrwpcaagqkyygrgplqiswnynygpagrdigfngla dpnrvaqdaviafktalwfwmnnvhrlmpqgfgatirainglecngnnpaqmnarvgyyk qycqqlrvdpgpnltc
Timeline for d4mcka1: