Lineage for d4m34a_ (4m34 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2700837Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2700838Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2703895Family a.25.1.0: automated matches [191307] (1 protein)
    not a true family
  6. 2703896Protein automated matches [190036] (60 species)
    not a true protein
  7. 2704302Species Mycobacterium smegmatis [TaxId:246196] [188322] (14 PDB entries)
  8. 2704307Domain d4m34a_: 4m34 A: [237292]
    automated match to d2z90a_
    complexed with cl, fe2, mg; mutant

Details for d4m34a_

PDB Entry: 4m34 (more details), 2.05 Å

PDB Description: Crystal structure of gated-pore mutant D138H of second DNA-Binding protein under starvation from Mycobacterium smegmatis
PDB Compounds: (A:) Putative starvation-induced DNA protecting protein/Ferritin and Dps

SCOPe Domain Sequences for d4m34a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4m34a_ a.25.1.0 (A:) automated matches {Mycobacterium smegmatis [TaxId: 246196]}
msarrtesdiqgfhatpefggnlqkvlvdlielslqgkqahwnvvgsnfrdlhlqldelv
dfaregsdtiaermraldavpdgrsdtvaatttlpefpaferstadvvdlittrinatvd
tirrvhdavdaedpstahllhglidglekqawlirsenrkv

SCOPe Domain Coordinates for d4m34a_:

Click to download the PDB-style file with coordinates for d4m34a_.
(The format of our PDB-style files is described here.)

Timeline for d4m34a_: