Lineage for d4m35a_ (4m35 A:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1264121Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1264122Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1265913Family a.25.1.0: automated matches [191307] (1 protein)
    not a true family
  6. 1265914Protein automated matches [190036] (19 species)
    not a true protein
  7. 1265983Species Mycobacterium smegmatis [TaxId:246196] [188322] (6 PDB entries)
  8. 1265987Domain d4m35a_: 4m35 A: [237291]
    automated match to d2z90a_
    complexed with cl, fe2, mg; mutant

Details for d4m35a_

PDB Entry: 4m35 (more details), 2.05 Å

PDB Description: Crystal structure of gated-pore mutant H126/141D of second DNA-Binding protein under starvation from Mycobacterium smegmatis
PDB Compounds: (A:) Putative starvation-induced DNA protecting protein/Ferritin and Dps

SCOPe Domain Sequences for d4m35a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4m35a_ a.25.1.0 (A:) automated matches {Mycobacterium smegmatis [TaxId: 246196]}
msarrtesdiqgfhatpefggnlqkvlvdlielslqgkqahwnvvgsnfrdlhlqldelv
dfaregsdtiaermraldavpdgrsdtvaatttlpefpaferstadvvdlittrinatvd
tirrvddavdaedpstadlldglidglekqawlirsenrkv

SCOPe Domain Coordinates for d4m35a_:

Click to download the PDB-style file with coordinates for d4m35a_.
(The format of our PDB-style files is described here.)

Timeline for d4m35a_: