SCOPe 2.06: Domain d4kvga1: 4kvg A:1-167

Lineage for d4kvga1 (4kvg A:1-167)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (79 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein automated matches [190047] (29 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186768] (179 PDB entries)

8. Domain d4kvga1: 4kvg A:1-167 [237284]
   Other proteins in same PDB: d4kvga2
   automated match to d1c1ya_
   complexed with edo, gtp, mg

Details for d4kvga1

PDB Entry: 4kvg, 1.65 Å

PDB Description: Crystal structure of RIAM RA-PH domains in complex with GTP bound Rap1

PDB Compounds: (A:) ras-related protein rap-1a

SCOPe Domain Sequences for d4kvga1:

Sequence, based on SEQRES records:

>d4kvga1 c.37.1.8 (A:1-167) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mreyklvvlgsvgvgksaltvqfvqgifvekydptiedsyrkqvevdcqqcmleildtag
teeftamrdlymkngqgfalvysitaqstfndlqdlreqilrvkdtedvpmilvgnkcdl
edervvgkeqgqnlarqwcncaflessakskinvneifydlvrqinr

Sequence, based on observed residues (ATOM records):

>d4kvga1 c.37.1.8 (A:1-167) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mreyklvvlgsvgvgksaltvqfvqgifvekydptiedsyrkqvevdcqqcmleildtag
ttamrdlymkngqgfalvysitaqstfndlqdlreqilrvkdtedvpmilvgnkcdlede
rvvgkeqgqnlarqwcncaflessakskinvneifydlvrqinr

Timeline for d4kvga1:

• d4kvga1 first appeared in SCOPe 2.03, called d4kvga_
  
• d4kvga1 was called d4kvga_ in SCOPe 2.05
  
• d4kvga1 appears in SCOPe 2.07
  
• d4kvga1 appears in the current release, SCOPe 2.08