Lineage for d4kvga1 (4kvg A:1-167)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2446887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2446888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2447791Family c.37.1.8: G proteins [52592] (80 protein domains)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2448880Protein automated matches [190047] (29 species)
    not a true protein
  7. 2448966Species Human (Homo sapiens) [TaxId:9606] [186768] (182 PDB entries)
  8. 2449037Domain d4kvga1: 4kvg A:1-167 [237284]
    Other proteins in same PDB: d4kvga2
    automated match to d1c1ya_
    complexed with edo, gtp, mg

Details for d4kvga1

PDB Entry: 4kvg (more details), 1.65 Å

PDB Description: Crystal structure of RIAM RA-PH domains in complex with GTP bound Rap1
PDB Compounds: (A:) ras-related protein rap-1a

SCOPe Domain Sequences for d4kvga1:

Sequence, based on SEQRES records: (download)

>d4kvga1 c.37.1.8 (A:1-167) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mreyklvvlgsvgvgksaltvqfvqgifvekydptiedsyrkqvevdcqqcmleildtag
teeftamrdlymkngqgfalvysitaqstfndlqdlreqilrvkdtedvpmilvgnkcdl
edervvgkeqgqnlarqwcncaflessakskinvneifydlvrqinr

Sequence, based on observed residues (ATOM records): (download)

>d4kvga1 c.37.1.8 (A:1-167) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mreyklvvlgsvgvgksaltvqfvqgifvekydptiedsyrkqvevdcqqcmleildtag
ttamrdlymkngqgfalvysitaqstfndlqdlreqilrvkdtedvpmilvgnkcdlede
rvvgkeqgqnlarqwcncaflessakskinvneifydlvrqinr

SCOPe Domain Coordinates for d4kvga1:

Click to download the PDB-style file with coordinates for d4kvga1.
(The format of our PDB-style files is described here.)

Timeline for d4kvga1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4kvga2
View in 3D
Domains from other chains:
(mouse over for more information)
d4kvgc_