SCOPe 2.08: Domain d4jzbb1: 4jzb B:2-362

Lineage for d4jzbb1 (4jzb B:2-362)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.128: Terpenoid synthases [48575] (1 superfamily)
   multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers

4. Superfamily a.128.1: Terpenoid synthases [48576] (6 families)
   duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J

5. Family a.128.1.0: automated matches [196408] (1 protein)
   not a true family

6. Protein automated matches [196409] (46 species)
   not a true protein

7. Species Leishmania major [TaxId:5664] [236738] (6 PDB entries)

8. Domain d4jzbb1: 4jzb B:2-362 [237282]
   Other proteins in same PDB: d4jzba2, d4jzbb2
   automated match to d4jzba_
   complexed with ca, ipe, na, p2h

Details for d4jzbb1

PDB Entry: 4jzb, 1.9 Å

PDB Description: crystal structure of leshmaniasis major farnesyl diphosphate synthase in complex with 1-(2-hydroxy-2,2-diphosphonoethyl)-3- phenylpyridinium, ipp and ca2+

PDB Compounds: (B:) farnesyl pyrophosphate synthase

SCOPe Domain Sequences for d4jzbb1:

Sequence; same for both SEQRES and ATOM records:

>d4jzbb1 a.128.1.0 (B:2-362) automated matches {Leishmania major [TaxId: 5664]}
ahmerfqkvyeevqefllgdaekrfemdvhrkgylksmmdttclggkynrglcvvdvaea
makdtqmdaaamervlhdacvcgwmiemlqahflveddimdhsktrrgkpcwylhpgvta
qvaindglillawatqmalhyfadrpflaevlrvfhdvdltttigqlydvtsmvdsakld
akvahanttdyveytpfnhrrivvyktayytywlplvmgllvsgtlekvdkkathkvamv
mgeyfqvqddvmdcftppeklgkigtdiedakcswlavtflttapaekvaefkanygstd
paavavikqlyteqnllarfeeyekavvaeveqliaaleaqnaafaasvkvlwsktykrq
k

Timeline for d4jzbb1:

• d4jzbb1 first appeared in SCOPe 2.03, called d4jzbb_
  
• d4jzbb1 appears in SCOPe 2.07