Lineage for d4jb6a2 (4jb6 A:255-413)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1626713Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 1626714Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 1627417Family c.95.1.0: automated matches [196908] (1 protein)
    not a true family
  6. 1627418Protein automated matches [196909] (45 species)
    not a true protein
  7. 1627820Species Pseudomonas aeruginosa [TaxId:287] [231543] (2 PDB entries)
  8. 1627826Domain d4jb6a2: 4jb6 A:255-413 [237278]
    automated match to d1ek4a2
    complexed with k; mutant

Details for d4jb6a2

PDB Entry: 4jb6 (more details), 2.4 Å

PDB Description: structure of pseudomonas aeruginosa fabf mutant c164q
PDB Compounds: (A:) 3-oxoacyl-[acyl-carrier-protein] synthase 2

SCOPe Domain Sequences for d4jb6a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4jb6a2 c.95.1.0 (A:255-413) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
yaelvgfgmsgdafhmtappedgagaarcmknalrdagldprqvdyinahgtstpagdia
eiaavksvfgehahalsmsstksmtghllgaagaveaifsvlalrdqvapptinldnpde
gcdldlvaheakprkidvalsnsfgfggtngtlvfrrfa

SCOPe Domain Coordinates for d4jb6a2:

Click to download the PDB-style file with coordinates for d4jb6a2.
(The format of our PDB-style files is described here.)

Timeline for d4jb6a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4jb6a1