Lineage for d4jb6a1 (4jb6 A:2-254)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1392123Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 1392124Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 1392829Family c.95.1.0: automated matches [196908] (1 protein)
    not a true family
  6. 1392830Protein automated matches [196909] (40 species)
    not a true protein
  7. 1393090Species Pseudomonas aeruginosa [TaxId:287] [231543] (2 PDB entries)
  8. 1393093Domain d4jb6a1: 4jb6 A:2-254 [237277]
    automated match to d2bywa1
    complexed with k; mutant

Details for d4jb6a1

PDB Entry: 4jb6 (more details), 2.4 Å

PDB Description: structure of pseudomonas aeruginosa fabf mutant c164q
PDB Compounds: (A:) 3-oxoacyl-[acyl-carrier-protein] synthase 2

SCOPe Domain Sequences for d4jb6a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4jb6a1 c.95.1.0 (A:2-254) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
srrrvvitgmgmlsplgldvpsswegilagrsgiapiehmdlsaystrfggsvkgfnvee
ylsakearkldlfiqyglaasfqavrdsglevtdanrerigvsmgsgiggltnienncrs
lfeqgprrispffvpgsiinmvsgflsihlglqgpnyalttaqttgthsigmaarniayg
eadvmvaggsemaacglglggfgaaralstrndeptrasrpwdrdrdgfvlsdgsgalvl
eeleharargari

SCOPe Domain Coordinates for d4jb6a1:

Click to download the PDB-style file with coordinates for d4jb6a1.
(The format of our PDB-style files is described here.)

Timeline for d4jb6a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4jb6a2