Class a: All alpha proteins [46456] (289 folds) |
Fold a.104: Cytochrome P450 [48263] (1 superfamily) multihelical |
Superfamily a.104.1: Cytochrome P450 [48264] (2 families) |
Family a.104.1.0: automated matches [191509] (1 protein) not a true family |
Protein automated matches [190847] (64 species) not a true protein |
Species Nocardia farcinica [TaxId:247156] [237265] (4 PDB entries) |
Domain d4j6cb_: 4j6c B: [237271] automated match to d1z8qa_ complexed with fmt, hem, k, mg, str |
PDB Entry: 4j6c (more details), 1.9 Å
SCOPe Domain Sequences for d4j6cb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4j6cb_ a.104.1.0 (B:) automated matches {Nocardia farcinica [TaxId: 247156]} phsdtltidpmitdlagetsrlraagpltridllgvpalavtghtlarqlltdtrlvkdi nawslwqsgtvtrqwpligmidvdrsmftvdgpehrrlrikttqaltrrrldalkptier yvaellddleragadgavvdlksvfayplpmrvisalmgvpsedqeqlltwykaffsilt pqderlrvidemhgyftemvrrktaepgddltsaliyatdgetplteeevignlqalvaa ghettvsliltavrallshpeqlrlvrdgeigwetaieetlrwdgpvihllmrfatedid lgdaviprgegvvmsyraigrditvhgadaddfditrataarhisfghgphicpgaalar leaaialpalftrfphlhpalpldqipnlpvltqndlshfpihlgr
Timeline for d4j6cb_: