SCOPe 2.05: Domain d4ixnb1: 4ixn B:1-223

Lineage for d4ixnb1 (4ixn B:1-223)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.10: Nitrogenase iron protein-like [52652] (16 proteins)
   core: parallel beta-sheet of 7 strands; order 3241567

6. Protein Hypothetical protein YjiA, N-terminal domain [89671] (1 species)
   homologue of the cobalamin biosynthesis protein CobW

7. Species Escherichia coli [TaxId:562] [89672] (3 PDB entries)

8. Domain d4ixnb1: 4ixn B:1-223 [237253]
   Other proteins in same PDB: d4ixna2, d4ixnb2
   automated match to d4ixna1
   complexed with so4, zn; mutant

Details for d4ixnb1

PDB Entry: 4ixn, 2.05 Å

PDB Description: Crystal Structure of Zn(II)-bound E37A,C66A,C67A triple mutant YjiA GTPase

PDB Compounds: (B:) Uncharacterized GTP-binding protein YjiA

SCOPe Domain Sequences for d4ixnb1:

Sequence; same for both SEQRES and ATOM records:

>d4ixnb1 c.37.1.10 (B:1-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]}
mnpiavtlltgflgagkttllrhilneqhgykiavianefgevsvddqligdratqiktl
tngciaasrsneledalldlldnldkgniqfdrlviectgmadpgpiiqtffshevlcqr
ylldgvialvdavhadeqmnqftiaqsqvgyadrilltktdvageaeklherlarinara
pvytvthgdidlgllfntngfmleenvvstkprfhfiadkqnd

Timeline for d4ixnb1:

• d4ixnb1 first appeared in SCOPe 2.03
  
• d4ixnb1 appears in SCOPe 2.04
  
• d4ixnb1 appears in SCOPe 2.06
  
• d4ixnb1 appears in the current release, SCOPe 2.08