Lineage for d3zmca_ (3zmc A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2010547Fold a.128: Terpenoid synthases [48575] (1 superfamily)
    multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers
  4. 2010548Superfamily a.128.1: Terpenoid synthases [48576] (6 families) (S)
    duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J
  5. 2010904Family a.128.1.0: automated matches [196408] (1 protein)
    not a true family
  6. 2010905Protein automated matches [196409] (36 species)
    not a true protein
  7. 2010977Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [229469] (6 PDB entries)
  8. 2010986Domain d3zmca_: 3zmc A: [237241]
    Other proteins in same PDB: d3zmcb2
    automated match to d3zcda_
    complexed with dms, gol, gpp, mg

Details for d3zmca_

PDB Entry: 3zmc (more details), 1.87 Å

PDB Description: native structure of farnesyl pyrophosphate synthase from pseudomonas aeruginosa pa01, with bound substrate molecule geranyl pyrophosphate.
PDB Compounds: (A:) Geranyltranstransferase

SCOPe Domain Sequences for d3zmca_:

Sequence, based on SEQRES records: (download)

>d3zmca_ a.128.1.0 (A:) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
miaayqarcqarvdaaldalfvapreelqrlyeamrysvmnggkrvrpllayaacealgg
apqradaaacavelihayslvhddlpamddddlrrgqptthrafdeatailaadglqala
fevladtrrnpqehavclemltrlaraagsagmvggqaidlgsvgvaldqaalevmhrhk
tgalieasvrlgalasgraepaslaaleryaeaiglafqvqddildvesdtatlgktqgk
dqahnkptypallgleaakgyalelrdlalaaldgfppsadplrqlaryiverr

Sequence, based on observed residues (ATOM records): (download)

>d3zmca_ a.128.1.0 (A:) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
miaayqarcqarvdaaldalfvapreelqrlyeamrysvmnggkrvrpllayaacealgg
apqradaaacavelihayslvhddlpamddddlrrgqptthrafdeatailaadglqala
fevladtrrnpqehavclemltrlaraagsagmvggqaidlgsldqaalevmhrhktgal
ieasvrlgalasgraepaslaaleryaeaiglafqvqddildvptypallgleaakgyal
elrdlalaaldgfppsadplrqlaryiverr

SCOPe Domain Coordinates for d3zmca_:

Click to download the PDB-style file with coordinates for d3zmca_.
(The format of our PDB-style files is described here.)

Timeline for d3zmca_: