SCOPe 2.08: Domain d4od3l1: 4od3 L:2-107

Lineage for d4od3l1 (4od3 L:2-107)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d4od3l1: 4od3 L:2-107 [237236]
   Other proteins in same PDB: d4od3h_, d4od3l2
   automated match to d2mcg11
   complexed with mes, zn

Details for d4od3l1

PDB Entry: 4od3, 2.62 Å

PDB Description: Crystal structure of human Fab CAP256-VRC26.07, a potent V1V2-directed HIV-1 neutralizing antibody

PDB Compounds: (L:) CAP256-VRC26.07 light chain

SCOPe Domain Sequences for d4od3l1:

Sequence; same for both SEQRES and ATOM records:

>d4od3l1 b.1.1.0 (L:2-107) automated matches {Human (Homo sapiens) [TaxId: 9606]}
avltqppsvsaapgqnvtiscsgsgsnignnfvswyqqrpgtapklliyesnkrpsgipd
rfsgsksgtsatlaitglqtgdeayyycatwaarlnsarvfgtgtmvtvlg

Timeline for d4od3l1:

• d4od3l1 first appeared in SCOPe 2.03
  
• d4od3l1 appears in SCOPe 2.07