SCOPe 2.03: Domain d4ocsl1: 4ocs L:3-107

Lineage for d4ocsl1 (4ocs L:3-107)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (23 species)
   not a true protein

7. Species Homo sapiens [TaxId:9606] [230172] (40 PDB entries)

8. Domain d4ocsl1: 4ocs L:3-107 [237230]
   Other proteins in same PDB: d4ocsl2
   automated match to d2mcg11

Details for d4ocsl1

PDB Entry: 4ocs, 1.9 Å

PDB Description: Crystal structure of human Fab CAP256-VRC26.10, a potent V1V2-directed HIV-1 neutralizing antibody

PDB Compounds: (L:) CAP256-VRC26.10 light chain

SCOPe Domain Sequences for d4ocsl1:

Sequence; same for both SEQRES and ATOM records:

>d4ocsl1 b.1.1.0 (L:3-107) automated matches {Homo sapiens [TaxId: 9606]}
vltqppsvsaapgqkvtiscsgsssnigdnyvswyqhlpgtapklliyentrrpsgipdr
fsgsksgtsatlaitglqtgdeadyycgtwdvrpnrgavfgtgtkvtvlg

Timeline for d4ocsl1:

• d4ocsl1 is new in SCOPe 2.03-stable
  
• d4ocsl1 appears in SCOPe 2.04
  
• d4ocsl1 appears in the current release, SCOPe 2.08