Class b: All beta proteins [48724] (177 folds) |
Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) |
Family b.18.1.5: beta-Galactosidase/glucuronidase, N-terminal domain [49803] (4 proteins) |
Protein beta-Galactosidase [49804] (2 species) |
Species Escherichia coli [TaxId:562] [49805] (42 PDB entries) Uniprot P00722 |
Domain d1dp0b3: 1dp0 B:13-219 [23723] Other proteins in same PDB: d1dp0a1, d1dp0a2, d1dp0a4, d1dp0a5, d1dp0b1, d1dp0b2, d1dp0b4, d1dp0b5, d1dp0c1, d1dp0c2, d1dp0c4, d1dp0c5, d1dp0d1, d1dp0d2, d1dp0d4, d1dp0d5 complexed with dms, mg, na |
PDB Entry: 1dp0 (more details), 1.7 Å
SCOPe Domain Sequences for d1dp0b3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dp0b3 b.18.1.5 (B:13-219) beta-Galactosidase {Escherichia coli [TaxId: 562]} rrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfawfpapeavpes wlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgcysltfnvdes wlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragenrlavmvlrws dgsyledqdmwrmsgifrdvsllhkpt
Timeline for d1dp0b3:
View in 3D Domains from same chain: (mouse over for more information) d1dp0b1, d1dp0b2, d1dp0b4, d1dp0b5 |