Lineage for d1dp0b3 (1dp0 B:13-219)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 12057Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
  4. 12058Superfamily b.18.1: Galactose-binding domain-like [49785] (8 families) (S)
  5. 12089Family b.18.1.5: beta-Galactosidase/glucuronidase, N-terminal domain [49803] (2 proteins)
  6. 12090Protein beta-Galactosidase [49804] (1 species)
  7. 12091Species Escherichia coli [TaxId:562] [49805] (7 PDB entries)
  8. 12093Domain d1dp0b3: 1dp0 B:13-219 [23723]
    Other proteins in same PDB: d1dp0a1, d1dp0a2, d1dp0a4, d1dp0a5, d1dp0b1, d1dp0b2, d1dp0b4, d1dp0b5, d1dp0c1, d1dp0c2, d1dp0c4, d1dp0c5, d1dp0d1, d1dp0d2, d1dp0d4, d1dp0d5

Details for d1dp0b3

PDB Entry: 1dp0 (more details), 1.7 Å

PDB Description: e. coli beta-galactosidase at 1.7 angstrom

SCOP Domain Sequences for d1dp0b3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dp0b3 b.18.1.5 (B:13-219) beta-Galactosidase {Escherichia coli}
rrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfawfpapeavpes
wlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgcysltfnvdes
wlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragenrlavmvlrws
dgsyledqdmwrmsgifrdvsllhkpt

SCOP Domain Coordinates for d1dp0b3:

Click to download the PDB-style file with coordinates for d1dp0b3.
(The format of our PDB-style files is described here.)

Timeline for d1dp0b3: