Lineage for d4ohfd_ (4ohf D:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2148571Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2148572Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 2149279Family c.108.1.23: 5' nucleotidase-like [142191] (1 protein)
    Pfam PF05761; the insertion domain cosists of 3-helical bundle and a pseudo beta-barrel; contains extra C-terminal long alpha hairpin subdomain (46556)
  6. 2149280Protein Cytosolic IMP-GMP specific 5'-nucleotidase [142192] (2 species)
  7. 2149281Species Legionella pneumophila [TaxId:272624] [237223] (2 PDB entries)
  8. 2149285Domain d4ohfd_: 4ohf D: [237227]
    Other proteins in same PDB: d4ohfa2, d4ohfb2
    automated match to d2bdea1
    complexed with 5gp, mg, po4

Details for d4ohfd_

PDB Entry: 4ohf (more details), 2.53 Å

PDB Description: crystal structure of cytosolic nucleotidase ii (lpg0095) in complex with gmp from legionella pneumophila, northeast structural genomics consortium target lgr1
PDB Compounds: (D:) cytosolic IMP-GMP specific 5'-nucleotidase

SCOPe Domain Sequences for d4ohfd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ohfd_ c.108.1.23 (D:) Cytosolic IMP-GMP specific 5'-nucleotidase {Legionella pneumophila [TaxId: 272624]}
thkvfvnriinmrkikligldmdhtlirynsknfeslvydlvkerlaesfhypeeikkfk
fnfddairglvidskngnilklsrygairlsyhgtkqisfsdqkkiyrsiyvdlgdpnym
aidtsfsiafcilygqlvdlkdtnpdkmpsyqaiaqdvqycvdkvhsdgtlkniiiknlk
kyvirekevveglkhfirygkkifiltnseysyskllldyalspfldkgehwqglfefvi
tlankprffydnlrflsvnpengtmtnvhgpivpgvyqggnakkftedlgvggdeilyig
dhiygdilrlkkdcnwrtalvveelgeeiasqiralpiekkigeamaikkeleqkyvdlc
trsidessqqydqeihdlqlqistvdlqisrllqeqnsfynpkwervfragaeesyfayq
vdrfaciymeklsdllehspmtyfranrrllahdid

SCOPe Domain Coordinates for d4ohfd_:

Click to download the PDB-style file with coordinates for d4ohfd_.
(The format of our PDB-style files is described here.)

Timeline for d4ohfd_: