Lineage for d1nuka_ (1nuk A:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 12057Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
  4. 12058Superfamily b.18.1: Galactose-binding domain-like [49785] (8 families) (S)
  5. 12085Family b.18.1.4: Ligand-binding domain of the ephb2 receptor tyrosine kinase [49800] (1 protein)
  6. 12086Protein Ligand-binding domain of the ephb2 receptor tyrosine kinase [49801] (1 species)
  7. 12087Species Mouse (Mus musculus) [TaxId:10090] [49802] (1 PDB entry)
  8. 12088Domain d1nuka_: 1nuk A: [23721]

Details for d1nuka_

PDB Entry: 1nuk (more details), 2.9 Å

PDB Description: crystal structure of the ligand-binding domain of the ephb2 receptor tyrosine kinase

SCOP Domain Sequences for d1nuka_:

Sequence, based on SEQRES records: (download)

>d1nuka_ b.18.1.4 (A:) Ligand-binding domain of the ephb2 receptor tyrosine kinase {Mouse (Mus musculus)}
eetlmdsttataelgwmvhppsgweevsgydenmntirtyqvcnvfessqnnwlrtkfir
rrgahrihvemkfsvrdcssipsvpgscketfnlyyyeadfdlatktfpnwmenpwvkvd
tiaadesfsqvdlggrvmkintevrsfgpvsrngfylafqdyggcmsliavrvfyr

Sequence, based on observed residues (ATOM records): (download)

>d1nuka_ b.18.1.4 (A:) Ligand-binding domain of the ephb2 receptor tyrosine kinase {Mouse (Mus musculus)}
eetlmdsttataelgwmvhppsgweevsgydntirtyqvcnvfessqnnwlrtkfirrrg
ahrihvemkfsvrdcssipsvpgscketfnlyyyeadfdlatktfpnwmenpwvkvdtia
adesfsqvdvmkintevrsfgpvsrngfylafqdyggcmsliavrvfyr

SCOP Domain Coordinates for d1nuka_:

Click to download the PDB-style file with coordinates for d1nuka_.
(The format of our PDB-style files is described here.)

Timeline for d1nuka_: