SCOPe 2.08: Domain d1nuka_: 1nuk A:

Lineage for d1nuka_ (1nuk A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll

4. Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families)

5. Family b.18.1.4: Ephrin receptor ligand binding domain [49800] (3 proteins)
   automatically mapped to Pfam PF01404

6. Protein Ligand-binding domain of the ephb2 receptor tyrosine kinase [49801] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [49802] (4 PDB entries)
   Uniprot P54763 27-207

8. Domain d1nuka_: 1nuk A: [23721]

Details for d1nuka_

PDB Entry: 1nuk, 2.9 Å

PDB Description: crystal structure of the ligand-binding domain of the ephb2 receptor tyrosine kinase

PDB Compounds: (A:) protein (tyrosine-protein kinase receptor eph)

SCOPe Domain Sequences for d1nuka_:

Sequence, based on SEQRES records:

>d1nuka_ b.18.1.4 (A:) Ligand-binding domain of the ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]}
eetlmdsttataelgwmvhppsgweevsgydenmntirtyqvcnvfessqnnwlrtkfir
rrgahrihvemkfsvrdcssipsvpgscketfnlyyyeadfdlatktfpnwmenpwvkvd
tiaadesfsqvdlggrvmkintevrsfgpvsrngfylafqdyggcmsliavrvfyr

Sequence, based on observed residues (ATOM records):

>d1nuka_ b.18.1.4 (A:) Ligand-binding domain of the ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]}
eetlmdsttataelgwmvhppsgweevsgydntirtyqvcnvfessqnnwlrtkfirrrg
ahrihvemkfsvrdcssipsvpgscketfnlyyyeadfdlatktfpnwmenpwvkvdtia
adesfsqvdvmkintevrsfgpvsrngfylafqdyggcmsliavrvfyr

Timeline for d1nuka_:

• d1nuka_ first appeared (with stable ids) in SCOP 1.55
  
• d1nuka_ appears in SCOPe 2.07