Lineage for d4ne2a_ (4ne2 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2110026Family c.37.1.6: Phosphoribulokinase/pantothenate kinase [52584] (6 protein domains)
  6. 2110066Protein automated matches [227115] (2 species)
    not a true protein
  7. 2110070Species Klebsiella pneumoniae [TaxId:507522] [226631] (3 PDB entries)
  8. 2110079Domain d4ne2a_: 4ne2 A: [237205]
    automated match to d4f7we_
    complexed with adp, mg, sh2

Details for d4ne2a_

PDB Entry: 4ne2 (more details), 1.9 Å

PDB Description: Pantothenamide-bound Pantothenate Kinase from Klebsiella pneumoniae
PDB Compounds: (A:) pantothenate kinase

SCOPe Domain Sequences for d4ne2a_:

Sequence, based on SEQRES records: (download)

>d4ne2a_ c.37.1.6 (A:) automated matches {Klebsiella pneumoniae [TaxId: 507522]}
lmtpylqfnrhqwaalrdsvpmtltedeitrlkginedlsleevaeiylplsrllnfyis
snlrrqavleqflgtngqripyiisiagsvavgksttarvlqallsrwpehrhvelittd
gflhpnsvlkerglmkkkgfpqsydmhrlvkfvsdlksgvpqatapvyshliydvipdgd
ktvaqpdilileglnvlqsgmdyphdphhvfvsdfvdfsiyvdapeellkswyinrflkf
regaftdpdsyfhnyaklskeeavdiatslwneinlmnlkenilptreraslimtksanh
svnqvrlrk

Sequence, based on observed residues (ATOM records): (download)

>d4ne2a_ c.37.1.6 (A:) automated matches {Klebsiella pneumoniae [TaxId: 507522]}
lmtpylqfnrhqwaalrtltedeitrlkginedlsleevaeiylplsrllnfyissnlrr
qavleqflgtngqripyiisiagsvavgksttarvlqallsrwpehrhvelittdgflhp
nsvlkerglmkkkgfpqsydmhrlvkfvsdlksgvpqatapvyshliydvipdgdktvaq
pdilileglnvlqsgmdyphdphhvfvsdfvdfsiyvdapeellkswyinrflkfregaf
tdpdsyfhnyaklskeeavdiatslwneinlmnlkenilptreraslimtksanhsvnqv
rlrk

SCOPe Domain Coordinates for d4ne2a_:

Click to download the PDB-style file with coordinates for d4ne2a_.
(The format of our PDB-style files is described here.)

Timeline for d4ne2a_: