Lineage for d1ciya1 (1ciy A:462-609)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2383785Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2383786Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2383865Family b.18.1.3: delta-Endotoxin, C-terminal domain [49796] (1 protein)
    automatically mapped to Pfam PF03944
  6. 2383866Protein delta-Endotoxin, C-terminal domain [49797] (5 species)
  7. 2383875Species Bacillus thuringiensis, CRYIA (A) [TaxId:1428] [49799] (1 PDB entry)
  8. 2383876Domain d1ciya1: 1ciy A:462-609 [23720]
    Other proteins in same PDB: d1ciya2, d1ciya3

Details for d1ciya1

PDB Entry: 1ciy (more details), 2.25 Å

PDB Description: insecticidal toxin: structure and channel formation
PDB Compounds: (A:) cryia(a)

SCOPe Domain Sequences for d1ciya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ciya1 b.18.1.3 (A:462-609) delta-Endotoxin, C-terminal domain {Bacillus thuringiensis, CRYIA (A) [TaxId: 1428]}
nniipssqitqipltkstnlgsgtsvvkgpgftggdilrrtspgqistlrvnitaplsqr
yrvriryasttnlqfhtsidgrpinqgnfsatmssgsnlqsgsfrtvgfttpfnfsngss
vftlsahvfnsgnevyidriefvpaevt

SCOPe Domain Coordinates for d1ciya1:

Click to download the PDB-style file with coordinates for d1ciya1.
(The format of our PDB-style files is described here.)

Timeline for d1ciya1: