Lineage for d4muma1 (4mum A:34-233)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2148571Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2148572Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 2148920Family c.108.1.8: 5'(3')-deoxyribonucleotidase (dNT-2) [82382] (2 protein domains)
    the insertion subdomain is a 4-helical bundle; dephosphorylates dUMP and dTMP
    automatically mapped to Pfam PF06941
  6. 2148927Protein automated matches [190171] (2 species)
    not a true protein
  7. 2148928Species Human (Homo sapiens) [TaxId:9606] [186899] (17 PDB entries)
  8. 2148933Domain d4muma1: 4mum A:34-233 [237199]
    Other proteins in same PDB: d4muma2
    automated match to d2i7da_
    complexed with cl, gol, mg, peg, pg4, po4, trs

Details for d4muma1

PDB Entry: 4mum (more details), 1.27 Å

PDB Description: Crystal structure of mitochondrial 5'(3')-deoxy ribonucleotidase alternative spliced variant
PDB Compounds: (A:) Mitochondrial 5' nucleotidase

SCOPe Domain Sequences for d4muma1:

Sequence, based on SEQRES records: (download)

>d4muma1 c.108.1.8 (A:34-233) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ralrvlvdmdgvladfeggflrkfrarfpdqpfialedrrgfwvseqygrlrpglsekai
siwesknfffeleplpgaveavkemaslqntdvfictspikmfkycpyekyawvekyfgp
dfleqivltrdktvvsadlliddrpditgkwpatgaeptpswehvlftachnqhlqlqpp
rrrlhswaddwkaildskrp

Sequence, based on observed residues (ATOM records): (download)

>d4muma1 c.108.1.8 (A:34-233) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ralrvlvdmdgvladfeggflrkfrarfpdqpfialedrrgfwvseqygrlrpglsekai
siwesknfffeleplpgaveavkemaslqntdvfictspikmfkycpyekyawvekyfgp
dfleqivltrdktvvsadlliddrpditgtgaeptpswehvlftachnqhlqlqpprrrl
hswaddwkaildskrp

SCOPe Domain Coordinates for d4muma1:

Click to download the PDB-style file with coordinates for d4muma1.
(The format of our PDB-style files is described here.)

Timeline for d4muma1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4muma2