Lineage for d4lkqb_ (4lkq B:)
- Root: SCOPe 2.05
Class a: All alpha proteins [46456] (286 folds) 
Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
multihelical; consists of two different alpha-helical bundlesSuperfamily a.211.1: HD-domain/PDEase-like [109604] (6 families) 
Family a.211.1.0: automated matches [191566] (1 protein)
not a true familyProtein automated matches [190983] (6 species)
not a true proteinSpecies Human (Homo sapiens) [TaxId:9606] [188676] (86 PDB entries) 
Domain d4lkqb_: 4lkq B: [237198]
automated match to d3wi2a_
complexed with 1xm, ni
Details for d4lkqb_
PDB Entry: 4lkq (more details), 1.62 Å
PDB Description: Crystal structure of PDE10A2 with fragment ZT017
PDB Compounds: (B:) cAMP and cAMP-inhibited cGMP 3',5'-cyclic phosphodiesterase 10ASCOPe Domain Sequences for d4lkqb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4lkqb_ a.211.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tsictseewqglmqftlpvrlckeielfhfdigpfenmwpgifvymvhrscgtscfelek
lcrfimsvkknyrrvpyhnwkhavtvahcmyailqnnhtlftdlerkglliaclchdldh
rgfsnsylqkfdhplaalyststmeqhhfsqtvsilqleghnifstlssseyeqvleiir
kaiiatdlalyfgnrkqleemyqtgslnlnnqshrdrviglmmtacdlcsvtklwpvtkl
tandiyaefwaegdemkklgiqpipmmdrdkkdevpqgqlgfynavaipcyttltqilpp
tepllkacrdnlsqwekvirgeetatw
SCOPe Domain Coordinates for d4lkqb_:
Click to download the PDB-style file with coordinates for d4lkqb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4lkqb_:
- d4lkqb_ first appeared in SCOPe 2.03
- d4lkqb_ appears in SCOPe 2.04
- d4lkqb_ is called d4lkqb1 in SCOPe 2.06
- d4lkqb_ appears in the current release, SCOPe 2.08, called d4lkqb1
View in 3D
