SCOPe 2.06: Domain d4lhbb_: 4lhb B:

Lineage for d4lhbb_ (4lhb B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.57: Molybdenum cofactor biosynthesis proteins [53217] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 5 strands; order: 21354, strand 5 is antiparallel to the rest; permutation of the Phosphorylase/hydrolase-like fold

4. Superfamily c.57.1: Molybdenum cofactor biosynthesis proteins [53218] (3 families)

5. Family c.57.1.0: automated matches [191349] (1 protein)
   not a true family

6. Protein automated matches [190284] (9 species)
   not a true protein

7. Species Pyrococcus furiosus [TaxId:186497] [235373] (1 PDB entry)

8. Domain d4lhbb_: 4lhb B: [237197]
   automated match to d4lhba_
   complexed with so4

Details for d4lhbb_

PDB Entry: 4lhb, 2.5 Å

PDB Description: Crystal structure of tungsten cofactor synthesizing protein MoaB from Pyrococcus furiosus

PDB Compounds: (B:) Molybdopterin adenylyltransferase

SCOPe Domain Sequences for d4lhbb_:

Sequence; same for both SEQRES and ATOM records:

>d4lhbb_ c.57.1.0 (B:) automated matches {Pyrococcus furiosus [TaxId: 186497]}
ktfkfgvitvsdkgakgeredksgpliieelsklgehvyykivpddkievlialfeaiks
gadvvvttggtgitrrditiesikplfdkelsfgevfraksyeevgyatvltratagiir
gqerivvvfslpgsvnavktgleiiksevfhilkhare

Timeline for d4lhbb_:

• d4lhbb_ first appeared in SCOPe 2.03
  
• d4lhbb_ appears in SCOPe 2.05
  
• d4lhbb_ appears in SCOPe 2.07
  
• d4lhbb_ appears in the current release, SCOPe 2.08