Lineage for d4lhbc_ (4lhb C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2890089Fold c.57: Molybdenum cofactor biosynthesis proteins [53217] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 5 strands; order: 21354, strand 5 is antiparallel to the rest; permutation of the Phosphorylase/hydrolase-like fold
  4. 2890090Superfamily c.57.1: Molybdenum cofactor biosynthesis proteins [53218] (3 families) (S)
  5. 2890232Family c.57.1.0: automated matches [191349] (1 protein)
    not a true family
  6. 2890233Protein automated matches [190284] (9 species)
    not a true protein
  7. 2890258Species Pyrococcus furiosus [TaxId:186497] [235373] (1 PDB entry)
  8. 2890261Domain d4lhbc_: 4lhb C: [237196]
    automated match to d4lhba_
    complexed with so4

Details for d4lhbc_

PDB Entry: 4lhb (more details), 2.5 Å

PDB Description: Crystal structure of tungsten cofactor synthesizing protein MoaB from Pyrococcus furiosus
PDB Compounds: (C:) Molybdopterin adenylyltransferase

SCOPe Domain Sequences for d4lhbc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lhbc_ c.57.1.0 (C:) automated matches {Pyrococcus furiosus [TaxId: 186497]}
apktfkfgvitvsdkgakgeredksgpliieelsklgehvyykivpddkievlialfeai
ksgadvvvttggtgitrrditiesikplfdkelsfgevfraksyeevgyatvltratagi
irgqerivvvfslpgsvnavktgleiiksevfhilkhare

SCOPe Domain Coordinates for d4lhbc_:

Click to download the PDB-style file with coordinates for d4lhbc_.
(The format of our PDB-style files is described here.)

Timeline for d4lhbc_: