Class a: All alpha proteins [46456] (289 folds) |
Fold a.2: Long alpha-hairpin [46556] (20 superfamilies) 2 helices; antiparallel hairpin, left-handed twist |
Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families) automatically mapped to Pfam PF00081 |
Family a.2.11.0: automated matches [227154] (1 protein) not a true family |
Protein automated matches [226859] (32 species) not a true protein |
Species Pseudoalteromonas haloplanktis [TaxId:228] [237179] (3 PDB entries) |
Domain d4l2ba1: 4l2b A:1-82 [237194] Other proteins in same PDB: d4l2ba2, d4l2bb2 automated match to d1pl4a1 complexed with fe, tre; mutant |
PDB Entry: 4l2b (more details), 1.97 Å
SCOPe Domain Sequences for d4l2ba1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4l2ba1 a.2.11.0 (A:1-82) automated matches {Pseudoalteromonas haloplanktis [TaxId: 228]} afelpslpyaidalephisketlefhhgkhhntyvvklnglipgtkfenksleeivsssd ggvfnnaaqiwnhtfywnslsp
Timeline for d4l2ba1: