![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.2: Long alpha-hairpin [46556] (20 superfamilies) 2 helices; antiparallel hairpin, left-handed twist |
![]() | Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families) ![]() automatically mapped to Pfam PF00081 |
![]() | Family a.2.11.0: automated matches [227154] (1 protein) not a true family |
![]() | Protein automated matches [226859] (38 species) not a true protein |
![]() | Species Pseudoalteromonas haloplanktis [TaxId:326442] [225959] (4 PDB entries) |
![]() | Domain d4l2da1: 4l2d A:1-82 [237188] Other proteins in same PDB: d4l2da2, d4l2db2, d4l2dc2, d4l2dd2 automated match to d3lioa1 complexed with fe2, tre |
PDB Entry: 4l2d (more details), 2.07 Å
SCOPe Domain Sequences for d4l2da1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4l2da1 a.2.11.0 (A:1-82) automated matches {Pseudoalteromonas haloplanktis [TaxId: 326442]} afelpslpyaidalephisketlefhhgkhhntyvvklnglipgtkfenksleeivcssd ggvfnnaaqiwnhtfywnslsp
Timeline for d4l2da1: