Lineage for d1d7pm_ (1d7p M:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2046279Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2046280Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2046303Family b.18.1.2: Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) [49791] (4 proteins)
    automatically mapped to Pfam PF00754
  6. 2046335Protein C2 domain of factor VIII [49794] (1 species)
  7. 2046336Species Human (Homo sapiens) [TaxId:9606] [49795] (5 PDB entries)
  8. 2046337Domain d1d7pm_: 1d7p M: [23718]
    complexed with cys, gol, so4

Details for d1d7pm_

PDB Entry: 1d7p (more details), 1.5 Å

PDB Description: crystal structure of the c2 domain of human factor viii at 1.5 a resolution at 1.5 a
PDB Compounds: (M:) coagulation factor viii precursor

SCOPe Domain Sequences for d1d7pm_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d7pm_ b.18.1.2 (M:) C2 domain of factor VIII {Human (Homo sapiens) [TaxId: 9606]}
lnscsmplgmeskaisdaqitassyftnmfatwspskarlhlqgrsnawrpqvnnpkewl
qvdfqktmkvtgvttqgvkslltsmyvkeflisssqdghqwtlffqngkvkvfqgnqdsf
tpvvncldpplltrylrihpqswvhqialrmevlgceaq

SCOPe Domain Coordinates for d1d7pm_:

Click to download the PDB-style file with coordinates for d1d7pm_.
(The format of our PDB-style files is described here.)

Timeline for d1d7pm_: