SCOPe 2.06: Domain d1d7pm_: 1d7p M:

Lineage for d1d7pm_ (1d7p M:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll

4. Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families)

5. Family b.18.1.2: Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) [49791] (4 proteins)
   automatically mapped to Pfam PF00754

6. Protein C2 domain of factor VIII [49794] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49795] (5 PDB entries)

8. Domain d1d7pm_: 1d7p M: [23718]
   complexed with cys, gol, so4

Details for d1d7pm_

PDB Entry: 1d7p, 1.5 Å

PDB Description: crystal structure of the c2 domain of human factor viii at 1.5 a resolution at 1.5 a

PDB Compounds: (M:) coagulation factor viii precursor

SCOPe Domain Sequences for d1d7pm_:

Sequence; same for both SEQRES and ATOM records:

>d1d7pm_ b.18.1.2 (M:) C2 domain of factor VIII {Human (Homo sapiens) [TaxId: 9606]}
lnscsmplgmeskaisdaqitassyftnmfatwspskarlhlqgrsnawrpqvnnpkewl
qvdfqktmkvtgvttqgvkslltsmyvkeflisssqdghqwtlffqngkvkvfqgnqdsf
tpvvncldpplltrylrihpqswvhqialrmevlgceaq

Timeline for d1d7pm_:

• d1d7pm_ first appeared (with stable ids) in SCOP 1.55
  
• d1d7pm_ appears in SCOPe 2.05
  
• d1d7pm_ appears in SCOPe 2.07
  
• d1d7pm_ appears in the current release, SCOPe 2.08