Lineage for d1d7pm_ (1d7p M:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 57188Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
  4. 57189Superfamily b.18.1: Galactose-binding domain-like [49785] (8 families) (S)
  5. 57200Family b.18.1.2: Coagulation factor C2 domain [49791] (2 proteins)
  6. 57207Protein C2 domain of factor VIII [49794] (1 species)
  7. 57208Species Human (Homo sapiens) [TaxId:9606] [49795] (2 PDB entries)
  8. 57209Domain d1d7pm_: 1d7p M: [23718]

Details for d1d7pm_

PDB Entry: 1d7p (more details), 1.5 Å

PDB Description: crystal structure of the c2 domain of human factor viii at 1.5 a resolution at 1.5 a

SCOP Domain Sequences for d1d7pm_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d7pm_ b.18.1.2 (M:) C2 domain of factor VIII {Human (Homo sapiens)}
lnscsmplgmeskaisdaqitassyftnmfatwspskarlhlqgrsnawrpqvnnpkewl
qvdfqktmkvtgvttqgvkslltsmyvkeflisssqdghqwtlffqngkvkvfqgnqdsf
tpvvncldpplltrylrihpqswvhqialrmevlgceaq

SCOP Domain Coordinates for d1d7pm_:

Click to download the PDB-style file with coordinates for d1d7pm_.
(The format of our PDB-style files is described here.)

Timeline for d1d7pm_: