Lineage for d1czvb_ (1czv B:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1776981Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 1776982Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 1777005Family b.18.1.2: Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) [49791] (4 proteins)
    automatically mapped to Pfam PF00754
  6. 1777013Protein C2 domain of factor V [49792] (2 species)
  7. 1777017Species Human (Homo sapiens) [TaxId:9606] [49793] (3 PDB entries)
  8. 1777021Domain d1czvb_: 1czv B: [23717]

Details for d1czvb_

PDB Entry: 1czv (more details), 2.4 Å

PDB Description: crystal structure of the c2 domain of human coagulation factor v: dimeric crystal form
PDB Compounds: (B:) protein (coagulation factor v)

SCOPe Domain Sequences for d1czvb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1czvb_ b.18.1.2 (B:) C2 domain of factor V {Human (Homo sapiens) [TaxId: 9606]}
cstplgmengkienkqitassfkkswwgdywepfrarlnaqgrvnawqakannnkqwlei
dllkikkitaiitqgckslssemyvksytihyseqgvewkpyrlkssmvdkifegntntk
ghvknffnppiisrfirvipktwnqsitlrlelfgcdiy

SCOPe Domain Coordinates for d1czvb_:

Click to download the PDB-style file with coordinates for d1czvb_.
(The format of our PDB-style files is described here.)

Timeline for d1czvb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1czva_