Lineage for d4je7a1 (4je7 A:2-190)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3000942Fold d.167: Peptide deformylase [56419] (1 superfamily)
    alpha-beta(5)-alpha; 3 layers: a/b/a; meander beta-sheet wraps around the C-terminal alpha-helix
  4. 3000943Superfamily d.167.1: Peptide deformylase [56420] (2 families) (S)
    nickel-dependent enzyme
  5. 3001128Family d.167.1.0: automated matches [191587] (1 protein)
    not a true family
  6. 3001129Protein automated matches [191055] (20 species)
    not a true protein
  7. 3001224Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [230479] (5 PDB entries)
  8. 3001227Domain d4je7a1: 4je7 A:2-190 [237167]
    Other proteins in same PDB: d4je7a2, d4je7b2
    automated match to d3g5ka_
    complexed with bb2, zn

Details for d4je7a1

PDB Entry: 4je7 (more details), 2.1 Å

PDB Description: Crystal structure of a human-like mitochondrial peptide deformylase in complex with actinonin
PDB Compounds: (A:) Peptide deformylase 1A, chloroplastic/mitochondrial

SCOPe Domain Sequences for d4je7a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4je7a1 d.167.1.0 (A:2-190) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
dlpeivasgdpvlhekarevdpgeigseriqkiiddmikvmrlapcvglaapqigvplri
ivledtkeyisyapkeeilaqerrhfdlmvmvnpvlkersnkkalffegcesvdgfraav
erylevvvtgydrqgkrievnasgwqarilqhecdhldgnlyvdkmvprtfrtvdnldlp
laegcpklg

SCOPe Domain Coordinates for d4je7a1:

Click to download the PDB-style file with coordinates for d4je7a1.
(The format of our PDB-style files is described here.)

Timeline for d4je7a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4je7a2