Lineage for d4jdga_ (4jdg A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2730190Fold a.124: Phospholipase C/P1 nuclease [48536] (1 superfamily)
    multihelical
  4. 2730191Superfamily a.124.1: Phospholipase C/P1 nuclease [48537] (3 families) (S)
    duplication: all chain but the N-terminal helix forms two structural repeats
  5. 2730226Family a.124.1.0: automated matches [194368] (1 protein)
    not a true family
  6. 2730227Protein automated matches [194369] (3 species)
    not a true protein
  7. 2730239Species Solanum lycopersicum [TaxId:4081] [194382] (3 PDB entries)
  8. 2730243Domain d4jdga_: 4jdg A: [237165]
    automated match to d4dj4a_
    complexed with po4, zn

Details for d4jdga_

PDB Entry: 4jdg (more details), 2.74 Å

PDB Description: structure of tomato bifunctional nuclease tbn1, variant n211d
PDB Compounds: (A:) Nuclease

SCOPe Domain Sequences for d4jdga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4jdga_ a.124.1.0 (A:) automated matches {Solanum lycopersicum [TaxId: 4081]}
wskeghvmtcriaqgllndeaahavkmllpeyvngdlsalcvwpdqvrhwykykwtsplh
fidtpdkacnfdyerdchdqhgvkdmcvagaiqnfttqlshyregtsdrrynmteallfl
shfmgdihqpmhvgftsdaggnsidlrwfrhksnlhhvwdreiiltaakdyyakdinlle
ediegdftdgiwsddlaswrecgnvfscvnkfatesiniackwgykgveagetlsddyfn
srlpivmkrvaqggirlamllnnvfg

SCOPe Domain Coordinates for d4jdga_:

Click to download the PDB-style file with coordinates for d4jdga_.
(The format of our PDB-style files is described here.)

Timeline for d4jdga_: