SCOPe 2.06: Domain d4iy7b_: 4iy7 B:

Lineage for d4iy7b_ (4iy7 B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
   main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest

4. Superfamily c.67.1: PLP-dependent transferases [53383] (10 families)

5. Family c.67.1.0: automated matches [191328] (1 protein)
   not a true family

6. Protein automated matches [190151] (121 species)
   not a true protein

7. Species Xanthomonas oryzae [TaxId:291331] [189393] (6 PDB entries)

8. Domain d4iy7b_: 4iy7 B: [237159]
   automated match to d4ixsa_
   protein/RNA complex; complexed with 0jo, gol, kou, pyr, ser, so4

Details for d4iy7b_

PDB Entry: 4iy7, 1.7 Å

PDB Description: crystal structure of cystathionine gamma lyase (XometC) from Xanthomonas oryzae pv. oryzae in complex with E-site serine, A-site external aldimine structure with serine and A-site external aldimine structure with aminoacrylate intermediates

PDB Compounds: (B:) Cystathionine gamma-lyase-like protein

SCOPe Domain Sequences for d4iy7b_:

Sequence; same for both SEQRES and ATOM records:

>d4iy7b_ c.67.1.0 (B:) automated matches {Xanthomonas oryzae [TaxId: 291331]}
alslatlaihggqspdpstgavmppiyatstyaqsspgehqgfeysrthnptrfayercv
aaleggtrafafasgmaatstvmelldagshvvamddlyggtfrlfervrrrtagldfsf
vdltdpaafkaairadtkmvwietptnpmlklvdiaaiaviarkhglltvvdntfaspml
qrplslgadlvvhsatkylnghsdmvggiavvgdnaelaeqmaflqnsiggvqgpfdsfl
alrglktlplrmrahcenalalaqwlethpaiekviypglashpqhvlakrqmsgfggiv
sivlkggfdaakrfcektelftlaeslggveslvnhpavmthasipvarreqlgisdalv
rlsvgiedlgdlrgdleralv

Timeline for d4iy7b_:

• d4iy7b_ first appeared in SCOPe 2.03
  
• d4iy7b_ appears in SCOPe 2.05
  
• d4iy7b_ appears in SCOPe 2.07
  
• d4iy7b_ appears in the current release, SCOPe 2.08