Lineage for d4iyob_ (4iyo B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2130990Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2130991Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2132229Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2132230Protein automated matches [190151] (121 species)
    not a true protein
  7. 2133020Species Xanthomonas oryzae [TaxId:291331] [189393] (6 PDB entries)
  8. 2133026Domain d4iyob_: 4iyo B: [237155]
    automated match to d4ixsa_
    complexed with 0jo, gol, nak, pyr, ser, so4

Details for d4iyob_

PDB Entry: 4iyo (more details), 1.8 Å

PDB Description: crystal structure of cystathionine gamma lyase from xanthomonas oryzae pv. oryzae (xometc) in complex with e-site serine, a-site serine, a- site external aldimine structure with aminoacrylate and a-site iminopropionate intermediates
PDB Compounds: (B:) Cystathionine gamma-lyase-like protein, LYS201A modified

SCOPe Domain Sequences for d4iyob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4iyob_ c.67.1.0 (B:) automated matches {Xanthomonas oryzae [TaxId: 291331]}
alslatlaihggqspdpstgavmppiyatstyaqsspgehqgfeysrthnptrfayercv
aaleggtrafafasgmaatstvmelldagshvvamddlyggtfrlfervrrrtagldfsf
vdltdpaafkaairadtkmvwietptnpmlklvdiaaiaviarkhglltvvdntfaspml
qrplslgadlvvhsatkylnghsdmvggiavvgdnaelaeqmaflqnsiggvqgpfdsfl
alrglktlplrmrahcenalalaqwlethpaiekviypglashpqhvlakrqmsgfggiv
sivlkggfdaakrfcektelftlaeslggveslvnhpavmthasipvarreqlgisdalv
rlsvgiedlgdlrgdleralv

SCOPe Domain Coordinates for d4iyob_:

Click to download the PDB-style file with coordinates for d4iyob_.
(The format of our PDB-style files is described here.)

Timeline for d4iyob_: