Lineage for d4iyoa_ (4iyo A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2895166Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2895167Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2896671Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2896672Protein automated matches [190151] (166 species)
    not a true protein
  7. 2898204Species Xanthomonas oryzae [TaxId:291331] [189393] (10 PDB entries)
  8. 2898209Domain d4iyoa_: 4iyo A: [237154]
    automated match to d4ixsa_
    complexed with 0jo, gol, nak, pyr, ser, so4

Details for d4iyoa_

PDB Entry: 4iyo (more details), 1.8 Å

PDB Description: crystal structure of cystathionine gamma lyase from xanthomonas oryzae pv. oryzae (xometc) in complex with e-site serine, a-site serine, a- site external aldimine structure with aminoacrylate and a-site iminopropionate intermediates
PDB Compounds: (A:) Cystathionine gamma-lyase-like protein

SCOPe Domain Sequences for d4iyoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4iyoa_ c.67.1.0 (A:) automated matches {Xanthomonas oryzae [TaxId: 291331]}
alslatlaihggqspdpstgavmppiyatstyaqsspgehqgfeysrthnptrfayercv
aaleggtrafafasgmaatstvmelldagshvvamddlyggtfrlfervrrrtagldfsf
vdltdpaafkaairadtkmvwietptnpmlklvdiaaiaviarkhglltvvdntfaspml
qrplslgadlvvhsatkylnghsdmvggiavvgdnaelaeqmaflqnsiggvqgpfdsfl
alrglktlplrmrahcenalalaqwlethpaiekviypglashpqhvlakrqmsgfggiv
sivlkggfdaakrfcektelftlaeslggveslvnhpavmthasipvarreqlgisdalv
rlsvgiedlgdlrgdleralv

SCOPe Domain Coordinates for d4iyoa_:

Click to download the PDB-style file with coordinates for d4iyoa_.
(The format of our PDB-style files is described here.)

Timeline for d4iyoa_: