Lineage for d4ixzb_ (4ixz B:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1379866Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 1379867Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 1380996Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 1380997Protein automated matches [190151] (66 species)
    not a true protein
  7. 1381356Species Xanthomonas oryzae [TaxId:291331] [189393] (6 PDB entries)
  8. 1381370Domain d4ixzb_: 4ixz B: [237151]
    automated match to d4ixsa_
    complexed with bct, bme, gol

Details for d4ixzb_

PDB Entry: 4ixz (more details), 2.07 Å

PDB Description: native structure of cystathionine gamma lyase (xometc) from xanthomonas oryzae pv. oryzae at ph 9.0
PDB Compounds: (B:) Cystathionine gamma-lyase-like protein

SCOPe Domain Sequences for d4ixzb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ixzb_ c.67.1.0 (B:) automated matches {Xanthomonas oryzae [TaxId: 291331]}
alslatlaihggqspdpstgavmppiyatstyaqsspgehqgfeysrthnptrfayercv
aaleggtrafafasgmaatstvmelldagshvvamddlyggtfrlfervrrrtagldfsf
vdltdpaafkaairadtkmvwietptnpmlklvdiaaiaviarkhglltvvdntfaspml
qrplslgadlvvhsatkylnghsdmvggiavvgdnaelaeqmaflqnsiggvqgpfdsfl
alrglktlplrmrahcenalalaqwlethpaiekviypglashpqhvlakrqmsgfggiv
sivlkggfdaakrfcektelftlaeslggveslvnhpavmthasipvarreqlgisdalv
rlsvgiedlgdlrgdleralv

SCOPe Domain Coordinates for d4ixzb_:

Click to download the PDB-style file with coordinates for d4ixzb_.
(The format of our PDB-style files is described here.)

Timeline for d4ixzb_: