Class b: All beta proteins [48724] (104 folds) |
Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) |
Superfamily b.18.1: Galactose-binding domain-like [49785] (8 families) |
Family b.18.1.2: Coagulation factor C2 domain [49791] (2 proteins) |
Protein C2 domain of factor V [49792] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [49793] (3 PDB entries) |
Domain d1czta_: 1czt A: [23715] |
PDB Entry: 1czt (more details), 1.87 Å
SCOP Domain Sequences for d1czta_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1czta_ b.18.1.2 (A:) C2 domain of factor V {Human (Homo sapiens)} gcstplgmengkienkqitassfkkswwgdywepfrarlnaqgrvnawqakannnkqwle idllkikkitaiitqgckslssemyvksytihyseqgvewkpyrlkssmvdkifegntnt kghvknffnppiisrfirvipktwnqsitlrlelfgcdiy
Timeline for d1czta_: