Lineage for d1czta_ (1czt A:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 12057Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
  4. 12058Superfamily b.18.1: Galactose-binding domain-like [49785] (8 families) (S)
  5. 12069Family b.18.1.2: Coagulation factor C2 domain [49791] (2 proteins)
  6. 12070Protein C2 domain of factor V [49792] (1 species)
  7. 12071Species Human (Homo sapiens) [TaxId:9606] [49793] (3 PDB entries)
  8. 12073Domain d1czta_: 1czt A: [23715]

Details for d1czta_

PDB Entry: 1czt (more details), 1.87 Å

PDB Description: crystal structure of the c2 domain of human coagulation factor v

SCOP Domain Sequences for d1czta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1czta_ b.18.1.2 (A:) C2 domain of factor V {Human (Homo sapiens)}
gcstplgmengkienkqitassfkkswwgdywepfrarlnaqgrvnawqakannnkqwle
idllkikkitaiitqgckslssemyvksytihyseqgvewkpyrlkssmvdkifegntnt
kghvknffnppiisrfirvipktwnqsitlrlelfgcdiy

SCOP Domain Coordinates for d1czta_:

Click to download the PDB-style file with coordinates for d1czta_.
(The format of our PDB-style files is described here.)

Timeline for d1czta_: