| Class b: All beta proteins [48724] (180 folds) |
| Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) ![]() |
| Family b.18.1.2: Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) [49791] (4 proteins) automatically mapped to Pfam PF00754 |
| Protein C2 domain of factor V [49792] (2 species) |
| Species Human (Homo sapiens) [TaxId:9606] [49793] (3 PDB entries) |
| Domain d1czta_: 1czt A: [23715] |
PDB Entry: 1czt (more details), 1.87 Å
SCOPe Domain Sequences for d1czta_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1czta_ b.18.1.2 (A:) C2 domain of factor V {Human (Homo sapiens) [TaxId: 9606]}
gcstplgmengkienkqitassfkkswwgdywepfrarlnaqgrvnawqakannnkqwle
idllkikkitaiitqgckslssemyvksytihyseqgvewkpyrlkssmvdkifegntnt
kghvknffnppiisrfirvipktwnqsitlrlelfgcdiy
Timeline for d1czta_: