Lineage for d1czta_ (1czt A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2774100Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2774101Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2774124Family b.18.1.2: Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) [49791] (4 proteins)
    automatically mapped to Pfam PF00754
  6. 2774147Protein C2 domain of factor V [49792] (2 species)
  7. 2774151Species Human (Homo sapiens) [TaxId:9606] [49793] (3 PDB entries)
  8. 2774153Domain d1czta_: 1czt A: [23715]

Details for d1czta_

PDB Entry: 1czt (more details), 1.87 Å

PDB Description: crystal structure of the c2 domain of human coagulation factor v
PDB Compounds: (A:) protein (coagulation factor v)

SCOPe Domain Sequences for d1czta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1czta_ b.18.1.2 (A:) C2 domain of factor V {Human (Homo sapiens) [TaxId: 9606]}
gcstplgmengkienkqitassfkkswwgdywepfrarlnaqgrvnawqakannnkqwle
idllkikkitaiitqgckslssemyvksytihyseqgvewkpyrlkssmvdkifegntnt
kghvknffnppiisrfirvipktwnqsitlrlelfgcdiy

SCOPe Domain Coordinates for d1czta_:

Click to download the PDB-style file with coordinates for d1czta_.
(The format of our PDB-style files is described here.)

Timeline for d1czta_: