Lineage for d4gone_ (4gon E:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2129295Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2129296Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2130081Family c.66.1.28: N6 adenine-specific DNA methylase, DAM [88788] (3 protein domains)
    automatically mapped to Pfam PF02086
  6. 2130108Protein automated matches [237125] (1 species)
    not a true protein
  7. 2130109Species Escherichia coli K-12 [TaxId:83333] [237133] (5 PDB entries)
  8. 2130123Domain d4gone_: 4gon E: [237147]
    automated match to d2ored_
    protein/DNA complex; complexed with 0y1

Details for d4gone_

PDB Entry: 4gon (more details), 2.72 Å

PDB Description: Crystal Structure of E. coli DNA Adenine Methyltransferase in Complex with Indole Aza-SAM
PDB Compounds: (E:) DNA adenine methylase

SCOPe Domain Sequences for d4gone_:

Sequence, based on SEQRES records: (download)

>d4gone_ c.66.1.28 (E:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
knraflkwaggkypllddikrhlpkgeclvepfvgagsvflntdfsryiladinsdlisl
ynivkmrtdeyvqaarelfvpetncaevyyqfreefnksqdpfrravlflylnrygyngl
crynlrgefnvpfgrykkpyfpeaelyhfaekaqnaffycesyadsmaraddasvvycdp
pyaplsatanftayhtnsftleqqahlaeiaeglverhipvlisnhdtmltrewyqrakl
hvvkvrrsissnggtrkkvdellalykp

Sequence, based on observed residues (ATOM records): (download)

>d4gone_ c.66.1.28 (E:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
knraflkwaggkypllddikrhlpkgeclvepfvgagsvflntdfsryiladinsdlisl
ynivkmrtdeyvqaarelfvpetncaevyyqfreefnksqdpfrravlflylnrygyngl
crynlrgefnvpfgrykkpyfpeaelyhfaekaqnaffycesyadsmaraddasvvycdp
pyaplsftleqqahlaeiaeglverhipvlisnhdtmltrewyqraklhvvkvkvdella
lykp

SCOPe Domain Coordinates for d4gone_:

Click to download the PDB-style file with coordinates for d4gone_.
(The format of our PDB-style files is described here.)

Timeline for d4gone_: