Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) |
Family c.66.1.28: N6 adenine-specific DNA methylase, DAM [88788] (3 proteins) automatically mapped to Pfam PF02086 |
Protein automated matches [237125] (1 species) not a true protein |
Species Escherichia coli K-12 [TaxId:83333] [237133] (5 PDB entries) |
Domain d4gbee_: 4gbe E: [237141] automated match to d2ored_ protein/DNA complex; complexed with sah |
PDB Entry: 4gbe (more details), 2.66 Å
SCOPe Domain Sequences for d4gbee_:
Sequence, based on SEQRES records: (download)
>d4gbee_ c.66.1.28 (E:) automated matches {Escherichia coli K-12 [TaxId: 83333]} knraflkwaggkypllddikrhlpkgeclvepfvgagsvflntdfsryiladinsdlisl ynivkmrtdeyvqaarelfvpetncaevyyqfreefnksqdpfrravlflylnrygyngl crynlrgefnvpfgrykkpyfpeaelyhfaekaqnaffycesyadsmaraddasvvycdp pyaplsatanftayhtnsftleqqahlaeiaeglverhipvlisnhdtmltrewyqrakl hvvkvrrsissnggtrkkvdellalykp
>d4gbee_ c.66.1.28 (E:) automated matches {Escherichia coli K-12 [TaxId: 83333]} knraflkwaggkypllddikrhlpkgeclvepfvgagsvflntdfsryiladinsdlisl ynivkmrtdeyvqaarelfvpetncaevyyqfreefnksqdpfrravlflylnrygyngl crynlrgefnvpfgrykkpyfpeaelyhfaekaqnaffycesyadsmaraddasvvycdp pyaplsftleqqahlaeiaeglverhipvlisnhdtmltrewyqraklhvvkvkvdella lykp
Timeline for d4gbee_: