Lineage for d1euu_2 (1euu 506-647)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 458865Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 458866Superfamily b.18.1: Galactose-binding domain-like [49785] (24 families) (S)
  5. 458867Family b.18.1.1: Galactose-binding domain [49786] (2 proteins)
  6. 458876Protein Sialidase, C-terminal domain [49789] (1 species)
  7. 458877Species Micromonospora viridifaciens [TaxId:1881] [49790] (2 PDB entries)
  8. 458879Domain d1euu_2: 1euu 506-647 [23713]
    Other proteins in same PDB: d1euu_1, d1euu_3

Details for d1euu_2

PDB Entry: 1euu (more details), 2.5 Å

PDB Description: sialidase or neuraminidase, large 68kd form

SCOP Domain Sequences for d1euu_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1euu_2 b.18.1.1 (506-647) Sialidase, C-terminal domain {Micromonospora viridifaciens}
qarmsiadvdseetaredgrasnvidgnpstfwhtewsradapgyphrisldlggthtis
glqytrrqnsaneqvadyeiytslngttwdgpvasgrfttslapqravfpardaryirlv
alseqtghkyaavaelevegqr

SCOP Domain Coordinates for d1euu_2:

Click to download the PDB-style file with coordinates for d1euu_2.
(The format of our PDB-style files is described here.)

Timeline for d1euu_2: