Lineage for d1euu_2 (1euu 506-647)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 370246Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 370247Superfamily b.18.1: Galactose-binding domain-like [49785] (21 families) (S)
  5. 370248Family b.18.1.1: Galactose-binding domain [49786] (2 proteins)
  6. 370256Protein Sialidase, C-terminal domain [49789] (1 species)
  7. 370257Species Micromonospora viridifaciens [TaxId:1881] [49790] (2 PDB entries)
  8. 370259Domain d1euu_2: 1euu 506-647 [23713]
    Other proteins in same PDB: d1euu_1, d1euu_3
    complexed with gal, na

Details for d1euu_2

PDB Entry: 1euu (more details), 2.5 Å

PDB Description: sialidase or neuraminidase, large 68kd form

SCOP Domain Sequences for d1euu_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1euu_2 b.18.1.1 (506-647) Sialidase, C-terminal domain {Micromonospora viridifaciens}
qarmsiadvdseetaredgrasnvidgnpstfwhtewsradapgyphrisldlggthtis
glqytrrqnsaneqvadyeiytslngttwdgpvasgrfttslapqravfpardaryirlv
alseqtghkyaavaelevegqr

SCOP Domain Coordinates for d1euu_2:

Click to download the PDB-style file with coordinates for d1euu_2.
(The format of our PDB-style files is described here.)

Timeline for d1euu_2: