SCOPe 2.08: Domain d1euua2: 1euu A:506-647

Lineage for d1euua2 (1euu A:506-647)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll

4. Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families)

5. Family b.18.1.1: Galactose-binding domain [49786] (2 proteins)
   automatically mapped to Pfam PF00754

6. Protein Sialidase, C-terminal domain [49789] (1 species)

7. Species Micromonospora viridifaciens [TaxId:1881] [49790] (4 PDB entries)
   Uniprot Q02834 47-647

8. Domain d1euua2: 1euu A:506-647 [23713]
   Other proteins in same PDB: d1euua1, d1euua3
   complexed with gal, na

Details for d1euua2

PDB Entry: 1euu, 2.5 Å

PDB Description: sialidase or neuraminidase, large 68kd form

PDB Compounds: (A:) sialidase

SCOPe Domain Sequences for d1euua2:

Sequence; same for both SEQRES and ATOM records:

>d1euua2 b.18.1.1 (A:506-647) Sialidase, C-terminal domain {Micromonospora viridifaciens [TaxId: 1881]}
qarmsiadvdseetaredgrasnvidgnpstfwhtewsradapgyphrisldlggthtis
glqytrrqnsaneqvadyeiytslngttwdgpvasgrfttslapqravfpardaryirlv
alseqtghkyaavaelevegqr

Timeline for d1euua2:

• d1euua2 first appeared (with stable ids) in SCOP 1.55, called d1euu_2
  
• d1euua2 appears in SCOPe 2.07