Lineage for d4cnca_ (4cnc A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2098542Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
    2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies
  4. 2098611Superfamily c.10.2: L domain-like [52058] (9 families) (S)
    less regular structure consisting of variable repeats
  5. 2098805Family c.10.2.0: automated matches [191489] (1 protein)
    not a true family
  6. 2098806Protein automated matches [190787] (11 species)
    not a true protein
  7. 2098812Species Human (Homo sapiens) [TaxId:9606] [188042] (12 PDB entries)
  8. 2098817Domain d4cnca_: 4cnc A: [237123]
    automated match to d1ozna_
    complexed with gol, na, nag, peg, so4

Details for d4cnca_

PDB Entry: 4cnc (more details), 1.77 Å

PDB Description: Crystal structure of human 5T4 (Wnt-activated inhibitory factor 1, Trophoblast glycoprotein)
PDB Compounds: (A:) trophoblast glycoprotein

SCOPe Domain Sequences for d4cnca_:

Sequence, based on SEQRES records: (download)

>d4cnca_ c.10.2.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dqcpalcecseaartvkcvnrnltevptdlpayvrnlfltgnqlavlpagafarrpplae
laalnlsgsrldevragafehlpslrqldlshnpladlspfafsgsnasvsapsplveli
lnhivppederqnrsfegmvvaallagralqglrrlelasnhflylprdvlaqlpslrhl
dlsnnslvsltyvsfrnlthleslhlednalkvlhngtlaelqglphirvfldnnpwvcd
chmadmvtwlketevvqgkdrltcaypekmrnrvllelnsadldc

Sequence, based on observed residues (ATOM records): (download)

>d4cnca_ c.10.2.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dqcpalcecseaartvkcvnrnltevptdlpayvrnlfltgnqlavlpagafarrpplae
laalnlsgsrldevragafehlpslrqldlshnpladlspfafssapsplvelilnhivp
persfegmvvaallagralqglrrlelasnhflylprdvlaqlpslrhldlsnnslvslt
yvsfrnlthleslhlednalkvlhngtlaelqglphirvfldnnpwvcdchmadmvtwlk
etevvqgkdrltcaypekmrnrvllelnsadldc

SCOPe Domain Coordinates for d4cnca_:

Click to download the PDB-style file with coordinates for d4cnca_.
(The format of our PDB-style files is described here.)

Timeline for d4cnca_: