Lineage for d1euta2 (1eut A:506-647)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 792799Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 792800Superfamily b.18.1: Galactose-binding domain-like [49785] (32 families) (S)
  5. 792801Family b.18.1.1: Galactose-binding domain [49786] (2 proteins)
  6. 792818Protein Sialidase, C-terminal domain [49789] (1 species)
  7. 792819Species Micromonospora viridifaciens [TaxId:1881] [49790] (6 PDB entries)
    Uniprot Q02834 47-647
  8. 792826Domain d1euta2: 1eut A:506-647 [23712]
    Other proteins in same PDB: d1euta1, d1euta3
    complexed with na

Details for d1euta2

PDB Entry: 1eut (more details), 2.5 Å

PDB Description: sialidase, large 68kd form, complexed with galactose
PDB Compounds: (A:) sialidase

SCOP Domain Sequences for d1euta2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1euta2 b.18.1.1 (A:506-647) Sialidase, C-terminal domain {Micromonospora viridifaciens [TaxId: 1881]}
qarmsiadvdseetaredgrasnvidgnpstfwhtewsradapgyphrisldlggthtis
glqytrrqnsaneqvadyeiytslngttwdgpvasgrfttslapqravfpardaryirlv
alseqtghkyaavaelevegqr

SCOP Domain Coordinates for d1euta2:

Click to download the PDB-style file with coordinates for d1euta2.
(The format of our PDB-style files is described here.)

Timeline for d1euta2: