Lineage for d1eut_2 (1eut 506-647)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 554850Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 554851Superfamily b.18.1: Galactose-binding domain-like [49785] (27 families) (S)
  5. 554852Family b.18.1.1: Galactose-binding domain [49786] (2 proteins)
  6. 554861Protein Sialidase, C-terminal domain [49789] (1 species)
  7. 554862Species Micromonospora viridifaciens [TaxId:1881] [49790] (4 PDB entries)
  8. 554865Domain d1eut_2: 1eut 506-647 [23712]
    Other proteins in same PDB: d1eut_1, d1eut_3
    complexed with na

Details for d1eut_2

PDB Entry: 1eut (more details), 2.5 Å

PDB Description: sialidase, large 68kd form, complexed with galactose

SCOP Domain Sequences for d1eut_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eut_2 b.18.1.1 (506-647) Sialidase, C-terminal domain {Micromonospora viridifaciens}
qarmsiadvdseetaredgrasnvidgnpstfwhtewsradapgyphrisldlggthtis
glqytrrqnsaneqvadyeiytslngttwdgpvasgrfttslapqravfpardaryirlv
alseqtghkyaavaelevegqr

SCOP Domain Coordinates for d1eut_2:

Click to download the PDB-style file with coordinates for d1eut_2.
(The format of our PDB-style files is described here.)

Timeline for d1eut_2: