SCOP 1.71: Domain d1eut_2: 1eut 506-647

Lineage for d1eut_2 (1eut 506-647)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll

4. Superfamily b.18.1: Galactose-binding domain-like [49785] (27 families)

5. Family b.18.1.1: Galactose-binding domain [49786] (2 proteins)

6. Protein Sialidase, C-terminal domain [49789] (1 species)

7. Species Micromonospora viridifaciens [TaxId:1881] [49790] (4 PDB entries)

8. Domain d1eut_2: 1eut 506-647 [23712]
   Other proteins in same PDB: d1eut_1, d1eut_3
   complexed with na

Details for d1eut_2

PDB Entry: 1eut, 2.5 Å

PDB Description: sialidase, large 68kd form, complexed with galactose

SCOP Domain Sequences for d1eut_2:

Sequence; same for both SEQRES and ATOM records:

>d1eut_2 b.18.1.1 (506-647) Sialidase, C-terminal domain {Micromonospora viridifaciens}
qarmsiadvdseetaredgrasnvidgnpstfwhtewsradapgyphrisldlggthtis
glqytrrqnsaneqvadyeiytslngttwdgpvasgrfttslapqravfpardaryirlv
alseqtghkyaavaelevegqr

Timeline for d1eut_2:

• d1eut_2 first appeared (with stable ids) in SCOP 1.55
  
• d1eut_2 appears in SCOP 1.69
  
• d1eut_2 is called d1euta2 in SCOP 1.73
  
• d1eut_2 appears in the current release, SCOPe 2.08, called d1euta2