Lineage for d4ciaa1 (4cia A:1-452)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2134062Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2134063Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2134616Family c.69.1.5: Serine carboxypeptidase-like [53499] (4 protein domains)
    automatically mapped to Pfam PF00450
  6. 2134617Protein Human 'protective protein', HPP [53504] (1 species)
    synonyms: cathepsin A, carboxypeptidase L
  7. 2134618Species Human (Homo sapiens) [TaxId:9606] [53505] (4 PDB entries)
  8. 2134621Domain d4ciaa1: 4cia A:1-452 [237118]
    Other proteins in same PDB: d4ciaa2, d4ciaa3
    automated match to d1ivya_
    complexed with 6kz, cd, nag

Details for d4ciaa1

PDB Entry: 4cia (more details), 1.98 Å

PDB Description: Crystal structure of cathepsin A, complexed with compound 1
PDB Compounds: (A:) lysosomal protective protein

SCOPe Domain Sequences for d4ciaa1:

Sequence, based on SEQRES records: (download)

>d4ciaa1 c.69.1.5 (A:1-452) Human 'protective protein', HPP {Human (Homo sapiens) [TaxId: 9606]}
apdqdeiqrlpglakqpsfrqysgylkgsgskhlhywfvesqkdpenspvvlwlnggpgc
ssldglltehgpflvqpdgvtleynpyswnlianvlylespagvgfsysddkfyatndte
vaqsnfealqdffrlfpeyknnklfltgesyagiyiptlavlvmqdpsmnlqglavgngl
ssyeqndnslvyfayyhgllgnrlwsslqthccsqnkcnfydnkdlecvtnlqevarivg
nsglniynlyapcaggvpshfryekdtvvvqdlgniftrlplkrmwhqallrsgdkvrmd
ppctnttaastylnnpyvrkalnipeqlpqwdmcnflvnlqyrrlyrsmnsqylkllssq
kyqillyngdvdmacnfmgdewfvdslnqkmevqrrpwlvkygdsgeqiagfvkefshia
fltikgaghmvptdkplaaftmfsrflnkqpy

Sequence, based on observed residues (ATOM records): (download)

>d4ciaa1 c.69.1.5 (A:1-452) Human 'protective protein', HPP {Human (Homo sapiens) [TaxId: 9606]}
apdqdeiqrlpglakqpsfrqysgylkgsgskhlhywfvesqkdpenspvvlwlnggpgc
ssldglltehgpflvqpdgvtleynpyswnlianvlylespagvgfsysddkfyatndte
vaqsnfealqdffrlfpeyknnklfltgesyagiyiptlavlvmqdpsmnlqglavgngl
ssyeqndnslvyfayyhgllgnrlwsslqthccsqnkcnfydnkdlecvtnlqevarivg
nsglniynlyapcaggvpmdppctnttaastylnnpyvrkalnipeqlpqwdmcnflvnl
qyrrlyrsmnsqylkllssqkyqillyngdvdmacnfmgdewfvdslnqkmevqrrpwlv
kygsgeqiagfvkefshiafltikgaghmvptdkplaaftmfsrflnkqpy

SCOPe Domain Coordinates for d4ciaa1:

Click to download the PDB-style file with coordinates for d4ciaa1.
(The format of our PDB-style files is described here.)

Timeline for d4ciaa1: